PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10004984m
Common NameCICLE_v10004984mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 440aa    MW: 49189.3 Da    PI: 5.9066
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10004984mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-32200254155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      k r+rWtpeLHe+Fveav++LGG e+AtPk +l+lm+v+ Lt++hvkSHLQkYR+
  Ciclev10004984m 200 KSRMRWTPELHEAFVEAVNRLGGGERATPKGVLKLMNVENLTIYHVKSHLQKYRT 254
                      68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.21197257IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.3E-31199257IPR009057Homeodomain-like
SuperFamilySSF466895.55E-18199255IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-24200254IPR006447Myb domain, plants
PfamPF002496.4E-11202253IPR001005SANT/Myb domain
PfamPF143791.2E-21285331IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 440 aa     Download sequence    Send to blast
MSNPQQISAS SSRFPDNMHF SSVSPHGRYS QNSPFISQSL RDEARLRSTH FSPSEGQPTP  60
LINHPEENKD NSWCIDPLQD FLDFPENDPG QTGLLESNTG DIASDDRAKR IEWWADQLIS  120
VEDGPEPNWS EVLADVNVTD ARQKVCSSIE HKVLKPSTDI PTQHPQVHPQ VHPQGQQHQP  180
VSNEEFHAVA NPLSMTPANK SRMRWTPELH EAFVEAVNRL GGGERATPKG VLKLMNVENL  240
TIYHVKSHLQ KYRTARHRPE SSEGTSEKKS NPTEDMKSLD TKTTMSITEA LRLQMEVQKR  300
LHEQLEIQRN LQLRIEEQGR HLQMMFEQRK QMENEKSKAS SSSLENPSAP LFESKQHSSP  360
NETSMATELD VAKTGADTSH VISAPEDSSA SLNQKQKAPE TKTGEEVDPD DDESGHKPVK  420
RARSEATAFS PKSALGNTL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00532DAPTransfer from AT5G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006420652.10.0hypothetical protein CICLE_v10004984mg
SwissprotQ8GUN53e-94PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLV4S0U90.0V4S0U9_9R
STRINGPOPTR_0019s03750.11e-160(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.31e-93G2-like family protein